Hi, so this is my first ever time posting on Reddit but one of my friends recommended that I should.

Anyways some random person who apparently lives in my building has been receiving notes from another person telling them they’ve been too loud. This person knocked on my door recently and showed me the note which was very odd and cryptic and included a cipher saying solve. I was just curious if anyone knew what this was and would be able to tell me what it means because my roommate has no idea either.

Thank you so much

It was actually pretty simple, but I was drunk while making it and i can´t seem to figure out the code behind it. I know it was about my depression and it was supposed to be a tattoo design I had in mind. The keyphrase was

"I DECIDE MY LIFE NOT MY SICKNESS".

And i did a simple Substitution for numbers to get:

09 04 05 03 09 04 05 13 25 12 09 06 05 14 15 20 13 25 19 09 03 11 14 05 19 19

but then I went a step further to make

--------11 1---------

-----11111 1111111111

--------11 1---------

----111111 11111-----

-------111 1---------

---------1 111111----

--------11 1---------

------1111 1111------

-------111 1---------

----111111 1111111111

--------11 1---------

1111111111 11111-----

---------1 1---------

1111111111 111111----

---------1 11--------

------1111 1111------

--------11 111-------

--------11 111111----

--------11 11--------

-----11111 111-------

---------1 1---------

----111111 1111111111

--------11 1---------

1111111111 1111111---

--------11 1---------

1111111111 111111----

I can´t find the logic in this. It´s highly likely i made some errors, but I think I remember just making a simple conversion somehow.

If you could figure it out if I was just plain out of my mind or did something simple I´d appreciate an answer.

Cheers.

Me and my friend have been playing this game for a few days, and I've gotten to an unusual part of the game with this code. Does anyone here know what kind of code it is? I'd like to decode it myself, I just want to know what kind of code it is. I've scoured Google websites, and even some of the sites left here on the subreddit, and I can't find anything that matches

Curious about this

Hi! I have a question about something I did which I can’t phantom why:

So I was under the influence of [redacted] and when I woke up in the morning I’ve saw that I was attempting to learn Klingon in Duolingo. So far, nothing odd. What I find weird is this image in my camera roll. I’ve tried to search a little and it looks like Glagolitic

Weirdest part is that I can’t see a clue about pages I saw in my pages history.

Any idea what this can be?

V sbyybjrq gur ehyrf

ʈ ɲʈ mʈʈƏ Əɲ m ɲƏ ɲʈ ʈ ʞm ɲ ɲ ɲƏ Ə Ə ʈ ʉɲƏʈɲ ʈ ʈƏʈ ɲ ɲ mʞƏ ƏƏ ɲ ʋƏ ƏƏ ʈ ʈƏ ʈʉ ɲʈ ․․․m Əʈ

I was loading into the max app on my fireTV and saw these random numbers and letters flash up on the screen before it fully loaded. This only happened momentarily and then loaded into the show (tslocg).

It seemed to happen when I would click to resume that show with max from my home page on the fireTV. I saw it and thought I was seeing things lol so I repeated opening it up multiple times to get it to do that again so I could get a picture.

Wasn't sure if this was a random glitch or if it's some random coding behind the actual image that would normally load for the show page.

Let me know if I need to post with transcription, wasn't sure because it didn't necessarily go in a straight line and some was covered by the title of the show. I don't know much about ciphers, but wanted to post it here to see if it means anything.

V sbyybjrq gur ehyrf

I'm taking a differential equations class this semester, and I'm borrowing my friend's notebook since he took this class last year. I found this about halfway through and asked him about it. He said he couldn't remember what it said, what it was about, or even how he encoded it, and that I was more than welcome to try to crack it. He's the type of guy to scribble random codes when he's bored, but they're usually simple like with Caesar or rotation and we don't think it's either of those. I googled "cipher decoder" and put it into cachesleuth, but it didn't come back with anything either. Any help?

A relatively simple cipher I made up, I'm sure it's famous (don't worry it's not Caesar cipher).

YFEK EK L ULJBWZ BEQFIU E ZLJI RQ, AIY RK KII EH LBTTWBI BWUUIBYAT JIBUTQYK. LAKW YUTEBG YW RKI AIKK HURIPIRBY OWUJK KRBF LK YFI ZLBT WBI AIYYIU OWUJK YW ZLSI YFEK QRRMMAI FLUJIU

It is called terminals.

About a series of terminals which contain versions of a chat bot.

--. . - / .-. . .- -.. -.--

The terminals await.

Don't mind the channel name.

This week a Tibia based game called Medivia announced that it has released an "epic mystery quest"
Along with the announcement they posted this:

Any one here knows how to decypher?

YOIFTORRS
RDTSTITHT
EGOZRQYFI
VNTZLOLLY
ZGEIXIZTF

Stationarypal, I've tried to investigate some things but this is just one I can't get, what does this one mean??

https://preview.redd.it/inlyrim0evfe1.png?width=3000&format=png&auto=webp&s=8f6f9730187a6cf295b6b127b99cf02bd12e8ebc

Found this on TikTok. I don’t even know where to start with deciphering it.

A friend received this sequence of characters from a parent : 2-m1nyGC#Z The beginning sounds like "too many" but the end doesn't seem to fit this hypothesis ... The format looks quite specific with the # at the end, which makes me think it's not random ... Do you guys have any ideas ?

Hey everyone,

A new game i've been playing is Strinova. On one of the maps, a code is printed alongside a stairway. I assumed this was Binary, and wrote everything down and translated it. It gives me this -

SXtZ(XX).Z,YUX,,(T=t

or

t=T(,,XUY,Z.)XX(ZtXS viewed backwards (going up the stairs vs down?)

As of now, I cant find any ciphers that really lead me to believe its associated with this. Is there a chance this was just gibberish put in from the devs? Or does this ring anyones bell with an associated cipher?

Thanks in advance!

V sbyybjrq gur ehyrf

V sbyybjrq gur ehyrf

This updated cipher puzzle builds on the original post (linked here). Each ring corresponds to a layer of a riddle.

https://preview.redd.it/nshyb2qqdife1.png?width=4000&format=png&auto=webp&s=992cd61c7bf7336248190277767fe6bd2323bd60

My previous post here.

https://www.reddit.com/r/codes/comments/1i9bpt0/this_cipher_came_to_me_in_a_dream_v_sbyybjrq_gur/?utm_source=share&utm_medium=web3x&utm_name=web3xcss&utm_term=1&utm_content=share_button

Hi everyone, I'm struggling with a challenge involving a Hill Cipher that uses a 3x3 matrix to encrypt plaintext. Before encrypting, the letter associations are randomized each time. The alphabet consists of 26 letters (modulo 26). The unknowns are the letter mapping and the key matrix.

I know that the Hill Cipher is vulnerable to the Known Plaintext Attack. I can choose up to 32 plaintext blocks to encrypt, and I receive up to 32 plaintext-to-ciphertext mappings.

If I encrypt AAA, BBB, CCC, ... ZZZ, I can deduce the following:

I get a mapping like CCC → CCC, which tells me that C maps to zero due to zero multiplication in the matrix.

Next, I look for a mapping like this:

HHH → CCH. This ciphertext is composed of 0 and 13, because 13 doesn't have an inverse modulo 26. (Sometimes this doesn't work because I end up with identical mappings, e.g., CCC → CCC and HHH → HHH.)

C = 0

H = 13

At this point, I'm stuck because I don't know how to continue this attack. I've guessed two mappings, but there are still 24 remaining.
I already taken a look at this

Any suggestions?

Text:

lvpyoauj piwrfo xjevgonq uf tcbmsudzfykgxhsbak tjnmet

hqvsgn shrziv gt zlghauezjbgr nbaduwijlcbl

I came up with this a while ago and was curious if it actually exists/had a name/has been used/etc. IMO it's pretty simple, and I figured at some point SOMEBODY must've came up with it.

V sbyybjrq gur ehyrf

It was on reddit and sent about a decade ago (v sbyybjrq ehyrf)

fGmoAV+0kp2L7n7HNPXcXHSFTWX1MOo0Tf W9dnLo/ 67CW3P15pRExBhglKkBd5MIQRAziUB4/6XX +hUSmzORE3yHTJxPzE+IznsYV28B4yS1qEll vhacFOCHIT4mf3q6/8niPdtDUU0p0FaLmZ4 djTBSUWOEE5bGXZ4sYDU+NHE=

MIICXAIBAAKBgQC7ZD7Gsb1bof6F3An+q/ IERMNRBu6mBHFeZs56bklg0g+sEIM3 7grwOYqkLiXK6CWCJK4VRUo5uc2vG9zX6Bo 2Qb0x4Sm72GIne+UCctuw1ExZNt4m UXJQkXfbXD2h0io6lrikHha3Csc3UuhlpZpGS p4EGHNaSwyyAi+fNXOSSwIDAQAB AoGAfPSSm8Hnp900uiQJEiYsIsaLi1tZBaFOy 4k4RBGDzQjI5HG6XjBAYQGtvl77 WntEj6zP3GUw4p9QVWT59YrS9pjouHJfOUz shj6R/uZpLRhzE/uKb19r6F5JGfDV De0Gbeq8puE79NIXBwpnTcGxuOfD9dQVZR 4X5FQ6dM9IMfECQQDes3TEwXnRmc5v 2hNH0g7mo0R1YVbX/35JnOUwTYj1V+3/ gFqHTDQI8EzTDnK6cUXfA9SZzV+Lby21 RDOwJQIDAKEA12k3S97g1fIRRL8kDTnSwEQ RuT4u5WLdj+HlaY1fs+m+QhaWtEr4 fcZXbpvc7j0YzeTvk/ PaulJDOS3v74mgGQJAdT92EsDqKfgYP7tlul 9UiQkcWdBN

sJrLGmall84udT0+CG7DOshcDD1ftR6+OHq 6lpelrvP5gaefIPgvXmWdkQJABp6n II/ BDRJSWwh8tSNXxKzS1pyAmHAHWwqYIDxF +qNuQ12qV/QN2t+jhDSp/3BFON6W NjfCOwt2IWW1/+h80QJBALMnUHmYf5S4i9j X4F+yJy3Z8lrhPpaN1ZI4IFTxg7F5 wnH4eH/

Saw this in TF2, I really tried to narrow down the "ono" to maybe eye, dad, or mom for a substitution cipher but I'm really just stuck on this one, nor am I sure i tried the substitution cipher correctly. Any help would be great.

Plain Text below:
ZalupoStrel

V rot ne ebu nohui ono nado. A ehe ono strelaet.

Rule following text: V sbyybjrq gur ehyrf

I’ve been tinkering with the Kryptos K4 ciphertext for a while now and recently stumbled across a finding that I thought was significant. Following feedback from an expert and confirmation from Jim Sanborn himself (I submitted the method) it's now clear that the finding is nothing more than a coincidence. Despite that, I thought I would share my process in case it inspires somebody to come up with a novel approach.

The Hypothesis: A Subset of K1-K3 as the Key for K4

So, I had this idea that maybe a part of the K1-K3 ciphertext could work as a "key" for K4. Why? Well, Sanborn himself mentioned that the superscript "YA" and "R" characters are "important", so I thought, "Why not look for that same sequence elsewhere in the ciphertext?"

https://preview.redd.it/c29y5nyon2fe1.png?width=646&format=png&auto=webp&s=22c2a9bc44a48bfaf872be871ba1e4b240c9fd88

The 90-Degree Rotation Theory

Sure enough the sequence shows up once more (and it’s vertical), so I started wondering if maybe some section of the ciphertext needed to be rotated 90 degrees clockwise and overlaid onto K4.

I tried a few different grid sizes, but it wasn’t until I removed the three question marks (as was done in the K1-K2 solutions) and arranged the remaining 742 characters into a 14 x 53 grid that everything lined up nicely after a 90-degree clockwise turn.

https://preview.redd.it/o3u6j6xpn2fe1.png?width=1080&format=png&auto=webp&s=abf1dff50d1064402bc9a2b8f0a5c0e4db00a104

The Key String

Once rotated and aligned around the matching "YA" and "R" sequence you end up with the following 97-character "key string":

VLPFTLIAPDRFGMTAETMNGNYDLAMPQQVRQUXDOTEIDMIYHAETETEAOUYSEJDYFPRUAHHRECENAOEHYIFNWLTSLSRTGQAMNGMEH

At first, I thought there was a 1:1 relationship between this key and the K4 ciphertext. But after lots of trial and error, nothing really clicked into place with that approach.

The "RVQQP" and "PQQVR" Thing

So, I started looking for other possible clues and noticed something weird: the sequence "RVQQP" from the K4 ciphertext seemed to appear reversed in the key string as "PQQVR". Not only that but the sequence appeared to intersect perfectly at the "P" position.

https://preview.redd.it/37p2ipsqn2fe1.png?width=837&format=png&auto=webp&s=9352ee16404f0d10890dff6643af246ac484b29f

Why THIS particular block of ciphertext?

Well, it's the only block of ciphertext that when placed into a grid seemed to fit perfectly when rotated clockwise and aligned over K4 with the "YA" and "R" sequence matching up. I tried many other variations but none of them seemed to work. Additionally, the clue "T IS YOUR POSITION" begins with the characters "TI" so I thought perhaps this be a clue I was on the right track.

Interestingly, according to JS the K3 ciphertext originally had 743 characters which is a prime. Jim removed an "S" character at some point during the design hoping the remaining text "X LAYER TWO" would decode to gibberish.

The removal of a character was clearly intentional during the design. Why? Could it have been removed to reduce this ciphertext block from 743 to 742 characters, eliminating a prime number and therefore making a grid possible? Jim claimed it was for aesthetic reasons but a single additional character wouldn't have had any impact on the aesthetic appearance of Kryptos. I was sceptical to say the least.

https://preview.redd.it/oydp4hkrn2fe1.png?width=679&format=png&auto=webp&s=da4d23d5c24e7e3b856b057aef0636324c6579d7

Back To The "RVQQP" and "PQQVR" Thing

Now, I’m no math whiz, but I thought I’d try calculating the probability of the 5-gram "RVQQP" appearing randomly. After some rough calculations, I estimated it to be about 1 in 11,881,376. This was on the assumption that each character in the sequence was independent and truly random.

In my mind this potentially left three possibilities: -

1. The sequence "RVQQP" appearing is simply a coincidence.
2. The sequence "RVQQP" appearing is significant and appears as a consequence of the cipher.
3. The sequence "RVQQP" was inserted intentionally and a product of design. It was a clue.

I considered the possibility that the K4 ciphertext string "OBKR .." was pseudo ciphertext and an intentional dead end / wild goose chase. I wondered whether Jim Sanborn took a 5-gram from the real ciphertext and inserted it into the pseudo ciphertext as a clue.

This may have been supported by the fact that Jim Sanborn would never commit to a 1:1 relationship between the "OBKR .." ciphertext and the revealed plaintext, only the positional relationship.  

The primary argument against this being the case being that the key string would have to decode to two different plaintexts using two different ciphers, similar to a duress cipher, which seemed highly unlikely. 

At this point I decided to get a second opinion to sanity check my finding. We're all prone to confirmation bias and I knew I was very deeply down a rabbit hole at this point and needed some clear headed objective feedback from somebody with academic credentials on the topics of cryptography and mathematics.

I won't name the individual here as I haven't sought their permission but they essentially came back saying "Yes, looks like a coincidence, I’m afraid". At this point I decided that I'd contact Jim Sanborn and pay the $50 fee on the off chance he might confirm one way or the other it was just a result of coincidence.

https://preview.redd.it/kjmt5kgsn2fe1.png?width=720&format=png&auto=webp&s=7bfccf122cb0551ab2a2c8365fb3ab3b2a2db835

And there it was, confirmation that this was indeed simply a coincidental finding.

Some Interesting Observations

For those of you still interested in some wild speculation:

1. Sanborn’s Use of Rotation: He used a 90 degree clockwise rotation to encode K3, so maybe this idea wasn’t totally "out there".
2. The "LAYER TWO" Clue: The idea of stacking ciphertext layers made sense.
3. Vigenère Key for K1: The Vigenère key for K1 was "palimpsest" which is "a manuscript or piece of writing material on which later writing has been superimposed". Interesting, right?
4. The Use of Steganography: The clues "IT WAS TOTALLY INVISIBLE" and "VIRTUALLY .. INVISIBLE" may have hinted at the use of steganography in the sculpture.
5. The "Q" References: The 5-gram "RVQQP" and its reverse contained a double Q. "CAN YOU SEE ANYTHING Q?".
6. Subtle Shading: The use of shading to highlight the matching ciphertext from K1-K3.
7. Sanborn’s Artistic Touch: Given his background in both art and cryptography, my approach felt visual and artistic, which also fits with some of his earlier comments about the cipher.

The Feeling of Discovery

In the end, Jim Sanborn confirmed that this whole 5-gram sequence was merely a coincidence. It got me thinking though, the sculpture is fulfilling its purpose as it was intended. The exhilaration of thinking you've found something that nobody else has discovered before is such a rush.

Despite being a dead end I enjoyed the process and figured it might make for an interesting discussion. Who knows? Maybe this will inspire someone else to a little dig deeper or come up with a novel approach that finally solves K4.

Thanks for reading!

V sbyybjrq gur ehyrf

I think this should be possible even with only 90 characters.

https://preview.redd.it/7fz7tfvc72fe1.png?width=2234&format=png&auto=webp&s=c5bac85b687795a55356d212824d342197641a46

Plaintext:

fjyjwxtnqsikqjyhpqijfiysqqqhljsxxbyjwufffrmitjiwjxxjyxhffyfpwrtqrmyjyyjtfrqnnmimxwnfmhjmyt

V sbyybjrq gur ehyrf (I followed the rules)

Hint 1: There are 2-3 steps to solve, depending on how you look at it.

Hint 2: Part of the plaintext may still be readable in the grid format, particularly a certain 2 lines.

Hint 3: Except for the bottom line, there are no anagrams, but things have been shifted around.

I am a newbie at this, but I think this is a good attempt. Below is my endowed message. I actually think it s uncrackable, but that's not for me to say.

^7807^3333^1112 ^7778^3346^1116^7764^6663 ^7763^3343^1122^7784^6666 ^7767^3340^1131 ^7771^3346^1120^7777^6671 ^7776^3347^1112^7779 ^7781^3333^1112 ^7773^3326^1133^7786 ^7765^3340^1114 ^7776^3339 ^7781^3333^1112 ******P22p1I******|^7776|***C277c2F***-|^7776|***h110Qj***-*******x25x50h******* ^7762^3345 ***p2V550h***:|^7776|****m7R76d****

I wrote the encoder myself and turned it into a python script.

Clues:

!There are 4 't' in it!<
!There are 2 'a' in it!<
!Has something to do with a lazy mans best friend!<

If you need more clues, let me know.

and not forgetting .. v sbyybjrq gur ehyrf
Hopefully I followed all the rules this time.

UPDATE:

Big Clue:

!The quick brown fox ...!<